PAPPA2 antibody (70R-5461)

Rabbit polyclonal PAPPA2 antibody raised against the N terminal of PAPPA2

Synonyms Polyclonal PAPPA2 antibody, Anti-PAPPA2 antibody, PAPP-A2 antibody, PAPPE antibody, PLAC3 antibody, Pappalysin 2 antibody
Specificity PAPPA2 antibody was raised against the N terminal of PAPPA2
Cross Reactivity Human
Applications WB
Immunogen PAPPA2 antibody was raised using the N terminal of PAPPA2 corresponding to a region with amino acids PPDLTENPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESL
Assay Information PAPPA2 Blocking Peptide, catalog no. 33R-7246, is also available for use as a blocking control in assays to test for specificity of this PAPPA2 antibody

Images

Western Blot analysis using PAPPA2 antibody (70R-5461)

PAPPA2 antibody (70R-5461) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 92 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PAPPA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PAPPA2 is a metalloproteinase which specifically cleaves IGFBP-5. It shows limited proteolysis toward IGFBP-3.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PAPPA2 antibody (70R-5461) | PAPPA2 antibody (70R-5461) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors