PARD6A antibody (70R-2600)

Rabbit polyclonal PARD6A antibody

Synonyms Polyclonal PARD6A antibody, Anti-PARD6A antibody, PARDA-6 antibody, PAR6C antibody, PARDA 6 antibody, TIP-40 antibody, PAR-6A antibody, Par-6 Partitioning Defective 6 Homolog Alpha antibody, PAR6alpha antibody, PARDA-6, PAR6 antibody, PARD6A, TAX40 antibody, PARDA 6
Cross Reactivity Human
Applications WB
Immunogen PARD6A antibody was raised using a synthetic peptide corresponding to a region with amino acids MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH
Assay Information PARD6A Blocking Peptide, catalog no. 33R-5734, is also available for use as a blocking control in assays to test for specificity of this PARD6A antibody

Images

Western Blot analysis using PARD6A antibody (70R-2600)

PARD6A antibody (70R-2600) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PARD6A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PARD6A antibody (70R-2600) | PARD6A antibody (70R-2600) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors