PARP11 antibody (70R-4435)

Rabbit polyclonal PARP11 antibody

Synonyms Polyclonal PARP11 antibody, Anti-PARP11 antibody, PARP 11, DKFZp779H0122 antibody, PARP-11, PARP 11 antibody, Poly (ADP-ribose) polymerase 11 antibody, PARP11, PARP-11 antibody, Adp-Ribose Polymerase 11 antibody, C12orf6 antibody
Cross Reactivity Human
Applications WB
Immunogen PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM

Images

Western Blot analysis using PARP11 antibody (70R-4435)

PARP11 antibody (70R-4435) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PARP11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The PARP11 gene is part of the poly (ADP-ribose) polymerase family.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PARP11 antibody (70R-4435) | PARP11 antibody (70R-4435) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors