PCMTD1 antibody (70R-1075)

Rabbit polyclonal PCMTD1 antibody

Synonyms Polyclonal PCMTD1 antibody, Anti-PCMTD1 antibody, PCMTD 1, PCMTD-1 antibody, PCMTD-1, D-Aspartate O-Methyltransferase Domain Containing 1 antibody, Protein-L-Isoaspartate antibody, PCMTD1, PCMTD 1 antibody, FLJ10883 antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen PCMTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGQNTWESKNILAVSFAPLVQPSKNDNGKPDSVGLPPCAVRNLQDLARIY
Assay Information PCMTD1 Blocking Peptide, catalog no. 33R-9092, is also available for use as a blocking control in assays to test for specificity of this PCMTD1 antibody

Images

Western Blot analysis using PCMTD1 antibody (70R-1075)

PCMTD1 antibody (70R-1075) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PCMTD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of PCMTD1 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCMTD1 antibody (70R-1075) | PCMTD1 antibody (70R-1075) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors