PCSK5 antibody (70R-5352)

Rabbit polyclonal PCSK5 antibody raised against the middle region of PCSK5

Synonyms Polyclonal PCSK5 antibody, Anti-PCSK5 antibody, PCSK5, PC6A antibody, PCSK 5, PC5 antibody, PC6 antibody, PCSK-5 antibody, PCSK-5, Proprotein Convertase Subtilisin/Kexin Type 5 antibody, PCSK 5 antibody, SPC6 antibody
Specificity PCSK5 antibody was raised against the middle region of PCSK5
Cross Reactivity Human
Applications WB
Immunogen PCSK5 antibody was raised using the middle region of PCSK5 corresponding to a region with amino acids CAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDIS
Assay Information PCSK5 Blocking Peptide, catalog no. 33R-1642, is also available for use as a blocking control in assays to test for specificity of this PCSK5 antibody

Images

Western Blot analysis using PCSK5 antibody (70R-5352)

PCSK5 antibody (70R-5352) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 89 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCSK5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCSK5 belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. PCSK5 mediates posttranslational endoproteolytic processing for several integrin alpha subunits. It is thought to process prorenin, pro-membrane type-1 matrix metalloproteinase and HIV-1 glycoprotein gp160. Two alternatively spliced transcripts are described for this gene but only one has its full length nature known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCSK5 antibody (70R-5352) | PCSK5 antibody (70R-5352) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors