PDHA1 antibody (70R-1094)

Rabbit polyclonal PDHA1 antibody

Synonyms Polyclonal PDHA1 antibody, Anti-PDHA1 antibody, PDHA1, PHE1A antibody, PDHA antibody, Pyruvate Dehydrogenase Alpha 1 antibody, PDHA 1, Lipoamide Alpha 1 antibody, PDHA-1 antibody, PDHCE1A antibody, PDHA 1 antibody, PDHA-1
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen PDHA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRKMLAAVSRVLSGASQKPASRVLVASRNFANDATFEIKKCDLHRLEEGP
Assay Information PDHA1 Blocking Peptide, catalog no. 33R-6366, is also available for use as a blocking control in assays to test for specificity of this PDHA1 antibody


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PDHA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The pyruvate dehydrogenase complex is a nuclear-encoded mitochondrial matrix multienzyme complex that provides the primary link between glycolysis and the tricarboxylic acid (TCA) cycle by catalyzing the irreversible conversion of pyruvate into acetyl-CoA. The PDH complex is composed of multiple copies of 3 enzymes: E1 (PDHA1); dihydrolipoyl transacetylase (DLAT); and dihydrolipoyl dehydrogenase (DLD).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors