PDHB antibody (70R-3744)

Rabbit polyclonal PDHB antibody

Synonyms Polyclonal PDHB antibody, Anti-PDHB antibody, Pyruvate Dehydrogenase Beta antibody, PHE1B antibody, Lipoamide Beta antibody, DKFZp564K0164 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PDHB antibody was raised using a synthetic peptide corresponding to a region with amino acids GLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAID
Assay Information PDHB Blocking Peptide, catalog no. 33R-3431, is also available for use as a blocking control in assays to test for specificity of this PDHB antibody


Western Blot analysis using PDHB antibody (70R-3744)

PDHB antibody (70R-3744) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDHB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PDHB antibody (70R-3744) | PDHB antibody (70R-3744) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors