PDP2 antibody (70R-3855)

Rabbit polyclonal PDP2 antibody raised against the middle region of PDP2

Synonyms Polyclonal PDP2 antibody, Anti-PDP2 antibody, Pyruvate Dehyrogenase Phosphatase Catalytic Subunit 2 antibody, PDP-2, PDP 2 antibody, PDP 2, KIAA1348 antibody, PDP2, PDP-2 antibody
Specificity PDP2 antibody was raised against the middle region of PDP2
Cross Reactivity Human
Applications WB
Immunogen PDP2 antibody was raised using the middle region of PDP2 corresponding to a region with amino acids CRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMED
Assay Information PDP2 Blocking Peptide, catalog no. 33R-1790, is also available for use as a blocking control in assays to test for specificity of this PDP2 antibody

Images

Western Blot analysis using PDP2 antibody (70R-3855)

PDP2 antibody (70R-3855) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PDP2 catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PDP2 antibody (70R-3855) | PDP2 antibody (70R-3855) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors