PDSS2 antibody (70R-2012)

Rabbit polyclonal PDSS2 antibody

Synonyms Polyclonal PDSS2 antibody, Anti-PDSS2 antibody, PDSS-2, PDSS 2 antibody, PDSS 2, Decaprenyl Diphosphate Synthase Subunit 2 antibody, C6orf210 antibody, DLP1 antibody, hDLP1 antibody, bA59I9.3 antibody, Prenyl decaprenyl diphosphate synthase subunit 2 antibody, PDSS-2 antibody, PDSS2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PDSS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS
Assay Information PDSS2 Blocking Peptide, catalog no. 33R-4010, is also available for use as a blocking control in assays to test for specificity of this PDSS2 antibody


Western Blot analysis using PDSS2 antibody (70R-2012)

PDSS2 antibody (70R-2012) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDSS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The isoprenoid chain of ubiquinone (coenzyme Q) varies in length between species and is determined by trans-polyprenyl diphosphate synthase. Humans possess a heterotetrameric decaprenyl diphosphate synthase composed of DPS1 and DLP1 (PDSS2) that produces Q10 ubiquinone.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PDSS2 antibody (70R-2012) | PDSS2 antibody (70R-2012) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors