PEO1 antibody (70R-4802)

Rabbit polyclonal PEO1 antibody raised against the middle region of Peo1

Synonyms Polyclonal PEO1 antibody, Anti-PEO1 antibody, C10orf2 antibody, PEO-1, SANDO antibody, TWINL antibody, PEOA3 antibody, PEO 1, PEO1, FLJ21832 antibody, PEO 1 antibody, PEO antibody, PEO-1 antibody
Specificity PEO1 antibody was raised against the middle region of Peo1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PEO1 antibody was raised using the middle region of Peo1 corresponding to a region with amino acids GVFRKFATDNNCHVTLVIHPRKEDDDKELQTASIFGSAKASQEADNVLIL
Assay Information PEO1 Blocking Peptide, catalog no. 33R-3637, is also available for use as a blocking control in assays to test for specificity of this PEO1 antibody


Western Blot analysis using PEO1 antibody (70R-4802)

PEO1 antibody (70R-4802) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PEO1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Twinkle is a mitochondrial protein with structural similarity to the phage T7 primase/helicase (GP4) and other hexameric ring helicases. The twinkle protein colocalizes with mtDNA in mitochondrial nucleoids, and its name derives from the unusual localization pattern reminiscent of twinkling stars.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PEO1 antibody (70R-4802) | PEO1 antibody (70R-4802) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors