PEX5 antibody (70R-2355)

Rabbit polyclonal PEX5 antibody raised against the middle region of PEX5

Synonyms Polyclonal PEX5 antibody, Anti-PEX5 antibody, PEX-5 antibody, PEX 5 antibody, Peroxisomal Biogenesis Factor 5 antibody, PEX 5, PEX5, PTS1R antibody, PXR1 antibody, PEX-5
Specificity PEX5 antibody was raised against the middle region of PEX5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PEX5 antibody was raised using the middle region of PEX5 corresponding to a region with amino acids LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL
Assay Information PEX5 Blocking Peptide, catalog no. 33R-5231, is also available for use as a blocking control in assays to test for specificity of this PEX5 antibody

Western Blot analysis using PEX5 antibody (70R-2355)

PEX5 antibody (70R-2355) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PEX5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PEX5 binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. The peroxisomal biogenesis disorders are a heterogeneous group with at least 14 complementation groups and with more than 1 phenotype being observed in cases falling into particular complementation groups.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using PEX5 antibody (70R-2355) | PEX5 antibody (70R-2355) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors