PGBD3 antibody (70R-4622)

Rabbit polyclonal PGBD3 antibody raised against the N terminal of PGBD3

Synonyms Polyclonal PGBD3 antibody, Anti-PGBD3 antibody, Piggybac Transposable Element Derived 3 antibody, PGBD 3, PGBD3, FLJ90201 antibody, PGBD 3 antibody, PGBD-3, PGBD-3 antibody
Specificity PGBD3 antibody was raised against the N terminal of PGBD3
Cross Reactivity Human
Applications WB
Immunogen PGBD3 antibody was raised using the N terminal of PGBD3 corresponding to a region with amino acids AESDSDDPSYAPKDDSPDEVPSTFTVQQPPPSRRRKMTKILCKWKKADLT
Assay Information PGBD3 Blocking Peptide, catalog no. 33R-1149, is also available for use as a blocking control in assays to test for specificity of this PGBD3 antibody

Images

Western Blot analysis using PGBD3 antibody (70R-4622)

PGBD3 antibody (70R-4622) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PGBD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. Anti-PGBD3 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. Anti-PGBD3 overlaps with the ERCC6 gene on chromosome 10, and pseudogenes of this locus have been found on chromosomes 4, 5 and 12.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PGBD3 antibody (70R-4622) | PGBD3 antibody (70R-4622) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors