PGDS antibody (70R-2383)

Rabbit polyclonal PGDS antibody raised against the N terminal of PGDS

Synonyms Polyclonal PGDS antibody, Anti-PGDS antibody, Prostaglandin D2 Synthase Hematopoietic antibody
Specificity PGDS antibody was raised against the N terminal of PGDS
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PGDS antibody was raised using the N terminal of PGDS corresponding to a region with amino acids EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEME
Assay Information PGDS Blocking Peptide, catalog no. 33R-2657, is also available for use as a blocking control in assays to test for specificity of this PGDS antibody


Western Blot analysis using PGDS antibody (70R-2383)

PGDS antibody (70R-2383) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PGDS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PGDS is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PGDS antibody (70R-2383) | PGDS antibody (70R-2383) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors