PGLS antibody (70R-3312)

Rabbit polyclonal PGLS antibody raised against the middle region of PGLS

Synonyms Polyclonal PGLS antibody, Anti-PGLS antibody, 6PGL antibody, 6-Phosphogluconolactonase antibody
Specificity PGLS antibody was raised against the middle region of PGLS
Cross Reactivity Human
Applications WB
Immunogen PGLS antibody was raised using the middle region of PGLS corresponding to a region with amino acids AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL
Assay Information PGLS Blocking Peptide, catalog no. 33R-1059, is also available for use as a blocking control in assays to test for specificity of this PGLS antibody


Immunohistochemical staining using PGLS antibody (70R-3312)

PGLS antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PGLS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PGLS belongs to the glucosamine/galactosamine-6-phosphate isomerase family, 6-phosphogluconolactonase subfamily. It is implicated in the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using PGLS antibody (70R-3312) | PGLS antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using PGLS antibody (70R-3312) | PGLS antibody (70R-3312) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors