PGM1 antibody (70R-3469)

Rabbit polyclonal PGM1 antibody raised against the middle region of PGM1

Synonyms Polyclonal PGM1 antibody, Anti-PGM1 antibody, PGM-1 antibody, PGM1, PGM 1 antibody, PGM 1, PGM-1, Phosphoglucomutase 1 antibody
Specificity PGM1 antibody was raised against the middle region of PGM1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PGM1 antibody was raised using the middle region of PGM1 corresponding to a region with amino acids ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI
Assay Information PGM1 Blocking Peptide, catalog no. 33R-1559, is also available for use as a blocking control in assays to test for specificity of this PGM1 antibody


Western Blot analysis using PGM1 antibody (70R-3469)

PGM1 antibody (70R-3469) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PGM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PGM1 is an isozyme of phosphoglucomutase (PGM) and belongs to the phosphohexose mutase family. There are several PGM isozymes, which are encoded by different genes and catalyze the transfer of phosphate between the 1 and 6 positions of glucose.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PGM1 antibody (70R-3469) | PGM1 antibody (70R-3469) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors