PGM2L1 antibody (70R-3547)

Rabbit polyclonal PGM2L1 antibody raised against the N terminal of PGM2L1

Synonyms Polyclonal PGM2L1 antibody, Anti-PGM2L1 antibody, BM32A antibody, PGML1 2, FLJ32029 antibody, Phosphoglucomutase 2-Like 1 antibody, PGML1-2, PGM2L1, PGML1-2 antibody, PGML1 2 antibody
Specificity PGM2L1 antibody was raised against the N terminal of PGM2L1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PGM2L1 antibody was raised using the N terminal of PGM2L1 corresponding to a region with amino acids KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLK
Assay Information PGM2L1 Blocking Peptide, catalog no. 33R-4321, is also available for use as a blocking control in assays to test for specificity of this PGM2L1 antibody


Western Blot analysis using PGM2L1 antibody (70R-3547)

PGM2L1 antibody (70R-3547) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PGM2L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PGM2L1 is the Glucose 1,6-bisphosphate synthase using 1,3-bisphosphoglycerate as a phosphate donor and a series of 1-phosphate sugars as acceptors, including glucose 1-phosphate, mannose 1-phosphate, ribose 1-phosphate and deoxyribose 1-phosphate. 5 or 6-phosphosugars are bad substrates, with the exception of glucose 6-phosphate. PGM2L1 also synthesizes ribose 1,5-bisphosphate. PGM2L1 has only low phosphopentomutase and phosphoglucomutase activities.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PGM2L1 antibody (70R-3547) | PGM2L1 antibody (70R-3547) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors