PHKG2 antibody (70R-2669)

Rabbit polyclonal PHKG2 antibody

Synonyms Polyclonal PHKG2 antibody, Anti-PHKG2 antibody, PHKG-2, PHKG2, Phosphorylase Kinase Gamma 2 antibody, PHKG 2, PHKG 2 antibody, PHKG-2 antibody
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen PHKG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV
Assay Information PHKG2 Blocking Peptide, catalog no. 33R-2309, is also available for use as a blocking control in assays to test for specificity of this PHKG2 antibody


Immunohistochemical staining using PHKG2 antibody (70R-2669)

PHKG2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (Indicated with Arrows) in Human kidney. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHKG2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mutations in PHKG2 along with PHKA2 and PHKB, all three different genes of phosphorylase kinase (Phk) subunits, can give rise to glycogen storage disease of the liver. The autosomal-recessive, liver-specific variant of Phk deficiency is caused by mutations in the gene encoding the testis/liver isoform of the catalytic gamma subunit, PHKG2.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using PHKG2 antibody (70R-2669) | PHKG2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (Indicated with Arrows) in Human kidney. Magnification is at 400X
  • Western Blot analysis using PHKG2 antibody (70R-2669) | PHKG2 antibody (70R-2669) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors