PHLDA1 antibody (70R-2176)

Rabbit polyclonal PHLDA1 antibody raised against the middle region of PHLDA1

Synonyms Polyclonal PHLDA1 antibody, Anti-PHLDA1 antibody, PHRIP antibody, TDAG51 antibody, DT1P1B11 antibody, MGC131738 antibody, Pleckstrin Homology-Like Domain Family A Member 1 antibody, PHLDA-1, PHLDA 1, PHLDA-1 antibody, PHLDA1, PHLDA 1 antibody
Specificity PHLDA1 antibody was raised against the middle region of PHLDA1
Cross Reactivity Human,Mouse
Applications WB
Immunogen PHLDA1 antibody was raised using the middle region of PHLDA1 corresponding to a region with amino acids PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP
Assay Information PHLDA1 Blocking Peptide, catalog no. 33R-6986, is also available for use as a blocking control in assays to test for specificity of this PHLDA1 antibody

Images

Western Blot analysis using PHLDA1 antibody (70R-2176)

PHLDA1 antibody (70R-2176) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHLDA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PHLDA1 is an evolutionarily conserved proline-histidine rich nuclear protein. It may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PHLDA1 antibody (70R-2176) | PHLDA1 antibody (70R-2176) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors