PIAS2 antibody (70R-2646)

Rabbit polyclonal PIAS2 antibody raised against the N terminal of PIAS2

Synonyms Polyclonal PIAS2 antibody, Anti-PIAS2 antibody, MIZ1 antibody, PIAS 2, PIAS2, PIAS 2 antibody, PIAS-2 antibody, PIASX-ALPHA antibody, miz antibody, PIASX-BETA antibody, MGC102682 antibody, SIZ2 antibody, Protein Inhibitor Of Activated Stat 2 antibody, PIAS-2, ZMIZ4 antibody
Specificity PIAS2 antibody was raised against the N terminal of PIAS2
Cross Reactivity Human
Applications WB
Immunogen PIAS2 antibody was raised using the N terminal of PIAS2 corresponding to a region with amino acids RELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPST
Assay Information PIAS2 Blocking Peptide, catalog no. 33R-7881, is also available for use as a blocking control in assays to test for specificity of this PIAS2 antibody

Images

Western blot analysis using PIAS2 antibody (70R-2646)

Recommended PIAS2 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIAS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Pias2 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. It plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using PIAS2 antibody (70R-2646) | Recommended PIAS2 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors