PIK3CB antibody (70R-1633)

Rabbit polyclonal PIK3CB antibody raised against the C terminal of PIK3CB

Synonyms Polyclonal PIK3CB antibody, Anti-PIK3CB antibody, PIK3CB, PIKCB-3 antibody, PIKCB 3, PIKCB-3, PIKCB 3 antibody, Phosphoinositide-3-Kinase Catalytic Beta Polypeptide antibody
Specificity PIK3CB antibody was raised against the C terminal of PIK3CB
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen PIK3CB antibody was raised using the C terminal of PIK3CB corresponding to a region with amino acids VKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKD
Assay Information PIK3CB Blocking Peptide, catalog no. 33R-9615, is also available for use as a blocking control in assays to test for specificity of this PIK3CB antibody


Western Blot analysis using PIK3CB antibody (70R-1633)

PIK3CB antibody (70R-1633) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 123 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PIK3CB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Phosphoinositide 3-kinases (PI3Ks) phosphorylate the 3-prime OH position of the inositol ring of inositol lipids. They have been implicated as participants in signaling pathways regulating cell growth by virtue of their activation in response to various mitogenic stimuli. PI3Ks are composed of a 110 kDa catalytic subunit, such as PIK3CB, and an 85 kDa adaptor subunit.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PIK3CB antibody (70R-1633) | PIK3CB antibody (70R-1633) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors