PIN4 antibody (70R-2106)

Rabbit polyclonal PIN4 antibody raised against the N terminal of PIN4

Synonyms Polyclonal PIN4 antibody, Anti-PIN4 antibody, PIN-4, PAR17 antibody, MGC138486 antibody, Protein peptidylprolyl cis/trans isomerase 4 antibody, PIN 4 antibody, PIN 4, PIN4, EPVH antibody, PAR14 antibody, PIN-4 antibody
Specificity PIN4 antibody was raised against the N terminal of PIN4
Cross Reactivity Human
Applications WB
Immunogen PIN4 antibody was raised using the N terminal of PIN4 corresponding to a region with amino acids MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSAD
Assay Information PIN4 Blocking Peptide, catalog no. 33R-6296, is also available for use as a blocking control in assays to test for specificity of this PIN4 antibody


Western Blot analysis using PIN4 antibody (70R-2106)

PIN4 antibody (70R-2106) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIN4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle and chromatin remodeling.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PIN4 antibody (70R-2106) | PIN4 antibody (70R-2106) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors