PLA2G5 antibody (70R-5351)

Rabbit polyclonal PLA2G5 antibody raised against the middle region of PLA2G5

Synonyms Polyclonal PLA2G5 antibody, Anti-PLA2G5 antibody, DKFZp686C2294 antibody, PLAG5-2 antibody, PLA2-10 antibody, PLAG5 2 antibody, PLAG5-2, PLAG5 2, GV-PLA2 antibody, PLA2G5, MGC46205 antibody, Phospholipase A2 Group V antibody, hVPLA(2) antibody
Specificity PLA2G5 antibody was raised against the middle region of PLA2G5
Cross Reactivity Human
Applications WB
Immunogen PLA2G5 antibody was raised using the middle region of PLA2G5 corresponding to a region with amino acids YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC
Assay Information PLA2G5 Blocking Peptide, catalog no. 33R-10222, is also available for use as a blocking control in assays to test for specificity of this PLA2G5 antibody


Western Blot analysis using PLA2G5 antibody (70R-5351)

PLA2G5 antibody (70R-5351) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLA2G5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PLA2G5 antibody (70R-5351) | PLA2G5 antibody (70R-5351) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors