PLAC1L antibody (70R-5416)

Rabbit polyclonal PLAC1L antibody raised against the middle region of PLAC1L

Synonyms Polyclonal PLAC1L antibody, Anti-PLAC1L antibody, Placenta-Specific 1-Like antibody, Placenta-specific 1-like protein antibody
Specificity PLAC1L antibody was raised against the middle region of PLAC1L
Cross Reactivity Human
Applications WB
Immunogen PLAC1L antibody was raised using the middle region of PLAC1L corresponding to a region with amino acids YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVW
Assay Information PLAC1L Blocking Peptide, catalog no. 33R-10184, is also available for use as a blocking control in assays to test for specificity of this PLAC1L antibody


Western Blot analysis using PLAC1L antibody (70R-5416)

PLAC1L antibody (70R-5416) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLAC1L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function ofPLAC1Lprotein is not widely studied, and is yet to be elucidated fully but it may play a role in placental development.
Expression Expressed in placenta. Localizes primarily to differentiated syncytiotrophoblast throughout gestation as well as to a small population of villous cytotrophoblasts. Also detected in maternal blood and rapidly disappears following delivery, but is not detected in other adult or fetal tissues examined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PLAC1L antibody (70R-5416) | PLAC1L antibody (70R-5416) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors