PLAC9 antibody (70R-3519)

Rabbit polyclonal PLAC9 antibody raised against the middle region of PLAC9

Synonyms Polyclonal PLAC9 antibody, Anti-PLAC9 antibody, MGC104710 antibody, PLAC 9 antibody, PLAC9, PLAC 9, PLAC-9 antibody, PLAC-9, Placenta-Specific 9 antibody
Specificity PLAC9 antibody was raised against the middle region of PLAC9
Cross Reactivity Human
Applications WB
Immunogen PLAC9 antibody was raised using the middle region of PLAC9 corresponding to a region with amino acids RRLDVMEEMVEKTVDHLGTEVKGLLGLLEELAWNLPPGPFSPAPDLLGDG
Assay Information PLAC9 Blocking Peptide, catalog no. 33R-8146, is also available for use as a blocking control in assays to test for specificity of this PLAC9 antibody

Images

Western Blot analysis using PLAC9 antibody (70R-3519)

PLAC9 antibody (70R-3519) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 10 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLAC9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of PLAC9 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PLAC9 antibody (70R-3519) | PLAC9 antibody (70R-3519) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors