Plastin 1 antibody (70R-3499)

Rabbit polyclonal Plastin 1 antibody

Synonyms Polyclonal Plastin 1 antibody, Anti-Plastin 1 antibody, Plastin 1 antibody, Plastin -1 antibody, Plastin 1, PLS1 antibody, Plastin 1, Plastin -1, L-plastin antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen Plastin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY
Assay Information Plastin 1 Blocking Peptide, catalog no. 33R-4152, is also available for use as a blocking control in assays to test for specificity of this Plastin 1 antibody

Images

Western Blot analysis using Plastin 1 antibody (70R-3499)

Plastin 1 antibody (70R-3499) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Plastin 1 antibody (70R-3499) | Plastin 1 antibody (70R-3499) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors