PLEKHA9 antibody (70R-4340)

Rabbit polyclonal PLEKHA9 antibody raised against the N terminal of PLEKHA9

Synonyms Polyclonal PLEKHA9 antibody, Anti-PLEKHA9 antibody, FLJ14156 antibody, PLEKHA-9, PLEKHA-9 antibody, PLEKHA 9 antibody, PLEKHA 9, Pleckstrin Homology Domain Containing Family A Member 9 antibody, PLEKHA9
Specificity PLEKHA9 antibody was raised against the N terminal of PLEKHA9
Cross Reactivity Human
Applications WB
Immunogen PLEKHA9 antibody was raised using the N terminal of PLEKHA9 corresponding to a region with amino acids VGTLLKSTCNTFLKTLEECMQIANAAFTSELLYHTPPGSPQLAMLKSSKM
Assay Information PLEKHA9 Blocking Peptide, catalog no. 33R-9574, is also available for use as a blocking control in assays to test for specificity of this PLEKHA9 antibody

Images

Western Blot analysis using PLEKHA9 antibody (70R-4340)

PLEKHA9 antibody (70R-4340) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLEKHA9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of PLEKHA9 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PLEKHA9 antibody (70R-4340) | PLEKHA9 antibody (70R-4340) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors