Plexin A4 antibody (70R-5387)

Rabbit polyclonal Plexin A4 antibody raised against the middle region of PLXNA4

Synonyms Polyclonal Plexin A4 antibody, Anti-Plexin A4 antibody, FAYV2820 antibody, Plexin A-4, PLXNA4 antibody, DKFZp566O0546 antibody, DKFZp434G0625 antibody, PLXNA4B antibody, PRO34003 antibody, FLJ35026 antibody, FLJ38287 antibody, Plexin A 4, KIAA1550 antibody, PLEXA4 antibody, DKFZp434G0625PRO34003 antibody, PLXNA4A antibody, Plexin A-4 antibody, Plexin A4, Plexin A 4 antibody
Specificity Plexin A4 antibody was raised against the middle region of PLXNA4
Cross Reactivity Human
Applications WB
Immunogen Plexin A4 antibody was raised using the middle region of PLXNA4 corresponding to a region with amino acids TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV
Assay Information Plexin A4 Blocking Peptide, catalog no. 33R-9241, is also available for use as a blocking control in assays to test for specificity of this Plexin A4 antibody


Western Blot analysis using Plexin A4 antibody (70R-5387)

Plexin A4 antibody (70R-5387) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLXNA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein mediates semaphorin receptor activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Plexin A4 antibody (70R-5387) | Plexin A4 antibody (70R-5387) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors