PLP2 antibody (70R-1891)

Rabbit polyclonal PLP2 antibody

Synonyms Polyclonal PLP2 antibody, Anti-PLP2 antibody, Proteolipid Protein 2 antibody, A4 antibody, PLP-2, PLP 2, PLP2, A4-LSB antibody, MGC126187 antibody, PLP 2 antibody, PLP-2 antibody
Cross Reactivity Human,Dog
Applications WB
Immunogen PLP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV
Assay Information PLP2 Blocking Peptide, catalog no. 33R-5507, is also available for use as a blocking control in assays to test for specificity of this PLP2 antibody


Western Blot analysis using PLP2 antibody (70R-1891)

PLP2 antibody (70R-1891) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PLP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PLP2 may play a role in cell differentiation in the intestinal epithelium.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PLP2 antibody (70R-1891) | PLP2 antibody (70R-1891) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors