PLXDC1 antibody (70R-4608)

Rabbit polyclonal PLXDC1 antibody raised against the N terminal of PLXDC1

Synonyms Polyclonal PLXDC1 antibody, Anti-PLXDC1 antibody, TEM7 antibody, PLXDC 1, DKFZp686F0937 antibody, FLJ36270 antibody, TEM3 antibody, PLXDC 1 antibody, Plexin Domain Containing 1 antibody, FLJ45632 antibody, PLXDC1, PLXDC-1 antibody, PLXDC-1
Specificity PLXDC1 antibody was raised against the N terminal of PLXDC1
Cross Reactivity Human
Applications WB
Immunogen PLXDC1 antibody was raised using the N terminal of PLXDC1 corresponding to a region with amino acids MDTLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQVKIHT
Assay Information PLXDC1 Blocking Peptide, catalog no. 33R-5878, is also available for use as a blocking control in assays to test for specificity of this PLXDC1 antibody


Western Blot analysis using PLXDC1 antibody (70R-4608)

PLXDC1 antibody (70R-4608) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLXDC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PLXDC1 (TEM7) may play significant role in proliferation and maintenance of neovascular endothelial cells in fibrovascular membranes. TEM7 may be molecular target for new diagnostic and therapeutic strategies for proliferative diabetic retinopathy. The expression level of TEM7 closely parallels histology-based prognostication of osteogenic sarcoma metastasis and, therefore, it is a therapeutic target.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PLXDC1 antibody (70R-4608) | PLXDC1 antibody (70R-4608) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors