PNMA1 antibody (70R-2058)

Rabbit polyclonal PNMA1 antibody raised against the middle region of PNMA1

Synonyms Polyclonal PNMA1 antibody, Anti-PNMA1 antibody, PNMA-1, Paraneoplastic Antigen Ma1 antibody, MA1 antibody, PNMA1, PNMA-1 antibody, PNMA 1 antibody, PNMA 1
Specificity PNMA1 antibody was raised against the middle region of PNMA1
Cross Reactivity Human
Applications WB
Immunogen PNMA1 antibody was raised using the middle region of PNMA1 corresponding to a region with amino acids LNTYQNPGEKLSAYVIRLEPLLQKVVEKGAIDKDNVNQARLEQVIAGANH
Assay Information PNMA1 Blocking Peptide, catalog no. 33R-5249, is also available for use as a blocking control in assays to test for specificity of this PNMA1 antibody


Western Blot analysis using PNMA1 antibody (70R-2058)

PNMA1 antibody (70R-2058) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PNMA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PNMA1 encodes a protein that is highly restricted to the brain and testis. Anti-PNMA1 reacts mainly with subnuclear elements (including the nucleoli) and to a lesser degree the cytoplasm.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PNMA1 antibody (70R-2058) | PNMA1 antibody (70R-2058) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors