PNMA3 antibody (70R-2050)

Rabbit polyclonal PNMA3 antibody raised against the N terminal of PNMA3

Synonyms Polyclonal PNMA3 antibody, Anti-PNMA3 antibody, PNMA-3 antibody, PNMA 3 antibody, MA3 antibody, Paraneoplastic Antigen Ma3 antibody, PNMA-3, MGC132756 antibody, MA5 antibody, PNMA3, MGC132758 antibody, PNMA 3
Specificity PNMA3 antibody was raised against the N terminal of PNMA3
Cross Reactivity Human
Applications WB
Immunogen PNMA3 antibody was raised using the N terminal of PNMA3 corresponding to a region with amino acids QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM
Assay Information PNMA3 Blocking Peptide, catalog no. 33R-7501, is also available for use as a blocking control in assays to test for specificity of this PNMA3 antibody


Western Blot analysis using PNMA3 antibody (70R-2050)

PNMA3 antibody (70R-2050) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PNMA3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the paraneoplastic antigen MA (PNMA) gene family, whose protein products share homology with retroviral Gag proteins. They are highly expressed in the brain and also in a range of tumors associated with serious neurological phenotypes. PMID:16407312 reports the presence of a functional -1 ribosomal frameshift signal (consisting of a heptanucleotide shift motif followed 3' by a pseudoknot structure) in this gene, however, the frame-shifted product has not been characterized.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PNMA3 antibody (70R-2050) | PNMA3 antibody (70R-2050) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors