PNMAL1 antibody (70R-3988)

Rabbit polyclonal PNMAL1 antibody raised against the middle region of PNMAL1

Synonyms Polyclonal PNMAL1 antibody, Anti-PNMAL1 antibody, PNMAL1, PNMAL-1, PNMAL 1 antibody, PNMAL 1, PNMAL-1 antibody, FLJ10781 antibody, Pnma-Like 1 antibody
Specificity PNMAL1 antibody was raised against the middle region of PNMAL1
Cross Reactivity Human
Applications WB
Immunogen PNMAL1 antibody was raised using the middle region of PNMAL1 corresponding to a region with amino acids APMRKKKKVSLGPVSYVLVDSEDGRKKPVMPKKGPGSRREASDQKAPRGQ
Assay Information PNMAL1 Blocking Peptide, catalog no. 33R-1430, is also available for use as a blocking control in assays to test for specificity of this PNMAL1 antibody

Images

Western Blot analysis using PNMAL1 antibody (70R-3988)

PNMAL1 antibody (70R-3988) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PNMAL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of PNMAL1 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PNMAL1 antibody (70R-3988) | PNMAL1 antibody (70R-3988) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors