PNPLA4 antibody (70R-5369)

Rabbit polyclonal PNPLA4 antibody raised against the C terminal of PNPLA4

Synonyms Polyclonal PNPLA4 antibody, Anti-PNPLA4 antibody, GS2 antibody, Patatin-Like Phospholipase Domain Containing 4 antibody, PNPLA 4 antibody, PNPLA-4, PNPLA4, PNPLA-4 antibody, DXS1283E antibody, PNPLA 4
Specificity PNPLA4 antibody was raised against the C terminal of PNPLA4
Cross Reactivity Human
Applications WB
Immunogen PNPLA4 antibody was raised using the C terminal of PNPLA4 corresponding to a region with amino acids SPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKM
Assay Information PNPLA4 Blocking Peptide, catalog no. 33R-8673, is also available for use as a blocking control in assays to test for specificity of this PNPLA4 antibody


Western Blot analysis using PNPLA4 antibody (70R-5369)

PNPLA4 antibody (70R-5369) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PNPLA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PNPLA4 is a keratinocyte retinyl ester hydrolase. The protein also catalyzes fatty acyl CoA-dependent and independent retinol esterification, using triolein as substrate and generates diacylglyceride and free fatty acid.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PNPLA4 antibody (70R-5369) | PNPLA4 antibody (70R-5369) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors