PNPLA8 antibody (70R-2261)

Rabbit polyclonal PNPLA8 antibody raised against the middle region of PNPLA8

Synonyms Polyclonal PNPLA8 antibody, Anti-PNPLA8 antibody, IPLA2(GAMMA) antibody, PNPLA 8 antibody, PNPLA-8, PNPLA8, PNPLA-8 antibody, IPLA2G antibody, IPLA2-2 antibody, Patatin-Like Phospholipase Domain Containing 8 antibody, PNPLA 8
Specificity PNPLA8 antibody was raised against the middle region of PNPLA8
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PNPLA8 antibody was raised using the middle region of PNPLA8 corresponding to a region with amino acids IDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPY
Assay Information PNPLA8 Blocking Peptide, catalog no. 33R-3926, is also available for use as a blocking control in assays to test for specificity of this PNPLA8 antibody


Western Blot analysis using PNPLA8 antibody (70R-2261)

PNPLA8 antibody (70R-2261) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 88 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PNPLA8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Phospholipase A2 catalyzes cleavage of fatty acids from phospholipids, thereby regulating membrane physical properties and the release of lipid second messengers and growth factors.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PNPLA8 antibody (70R-2261) | PNPLA8 antibody (70R-2261) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors