PNRC2 antibody (70R-3985)

Rabbit polyclonal PNRC2 antibody raised against the middle region of PNRC2

Synonyms Polyclonal PNRC2 antibody, Anti-PNRC2 antibody, PNRC2, FLJ20312 antibody, PNRC-2 antibody, PNRC 2 antibody, PNRC-2, MGC99541 antibody, PNRC 2, Proline-Rich Nuclear Receptor Coactivator 2 antibody
Specificity PNRC2 antibody was raised against the middle region of PNRC2
Cross Reactivity Human
Applications WB
Immunogen PNRC2 antibody was raised using the middle region of PNRC2 corresponding to a region with amino acids NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFN
Assay Information PNRC2 Blocking Peptide, catalog no. 33R-6847, is also available for use as a blocking control in assays to test for specificity of this PNRC2 antibody


Western Blot analysis using PNRC2 antibody (70R-3985)

PNRC2 antibody (70R-3985) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PNRC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PNRC2 is involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery.PNRC2 may act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. PNRC2 is required for UPF1/RENT1 localization to the P-body. PNRC2 also acts as a nuclear receptor coactivator. PNRC2 may play a role in controlling the energy balance between energy storage and energy expenditure.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PNRC2 antibody (70R-3985) | PNRC2 antibody (70R-3985) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors