POFUT2 antibody (70R-1592)

Rabbit polyclonal POFUT2 antibody raised against the C terminal of POFUT2

Synonyms Polyclonal POFUT2 antibody, Anti-POFUT2 antibody, C21orf80 antibody, POFUT 2 antibody, POFUT-2 antibody, FUT13 antibody, POFUT2, POFUT 2, POFUT-2, Protein O-Fucosyltransferase 2 antibody
Specificity POFUT2 antibody was raised against the C terminal of POFUT2
Cross Reactivity Human
Applications IHC, WB
Immunogen POFUT2 antibody was raised using the C terminal of POFUT2 corresponding to a region with amino acids RFEPTWEELELYKDGGVAIIDQWICAHARCLPTSLSAESGSGGFQRFFCP
Assay Information POFUT2 Blocking Peptide, catalog no. 33R-7900, is also available for use as a blocking control in assays to test for specificity of this POFUT2 antibody

Images

Immunohistochemical staining using POFUT2 antibody (70R-1592)

POFUT2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of POFUT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POFUT2 catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in thrombospondin type 1 repeats.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using POFUT2 antibody (70R-1592) | POFUT2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using POFUT2 antibody (70R-1592) | POFUT2 antibody (70R-1592) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using POFUT2 antibody (70R-1592) | POFUT2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Surface mucous cells and Epithelial cells of fundic gland (arrows) in Human Stomach. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors