POFUT2 antibody (70R-5486)

Rabbit polyclonal POFUT2 antibody raised against the N terminal of POFUT2

Synonyms Polyclonal POFUT2 antibody, Anti-POFUT2 antibody, POFUT-2 antibody, FUT13 antibody, Protein O-Fucosyltransferase 2 antibody, POFUT 2, POFUT-2, C21orf80 antibody, POFUT2, POFUT 2 antibody
Specificity POFUT2 antibody was raised against the N terminal of POFUT2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen POFUT2 antibody was raised using the N terminal of POFUT2 corresponding to a region with amino acids GAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWG
Assay Information POFUT2 Blocking Peptide, catalog no. 33R-3149, is also available for use as a blocking control in assays to test for specificity of this POFUT2 antibody


Western Blot analysis using POFUT2 antibody (70R-5486)

POFUT2 antibody (70R-5486) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POFUT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POFUT2 catalyzes the reaction that attaches fucose through an O-glycosidic linkage to a conserved serine or threonine residue in thrombospondin type 1 repeats. Fucose is typically found as a terminal modification of branched chain glycoconjugates, but it also exists in direct O-linkage to serine or threonine residues within cystine knot motifs in epidermal growth factor-like repeats or thrombospondin.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using POFUT2 antibody (70R-5486) | POFUT2 antibody (70R-5486) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors