POLI antibody (70R-4581)

Rabbit polyclonal POLI antibody

Synonyms Polyclonal POLI antibody, Anti-POLI antibody, RAD3OB antibody, RAD30B antibody, Polymerase (DNA directed) iota antibody
Cross Reactivity Human
Applications WB
Immunogen POLI antibody was raised using a synthetic peptide corresponding to a region with amino acids PVVERLGFDENFVDLTEMVEKRLQQLQSDELSAVTVSGHVYNNQSINLLD
Assay Information POLI Blocking Peptide, catalog no. 33R-7428, is also available for use as a blocking control in assays to test for specificity of this POLI antibody

Images

Western Blot analysis using POLI antibody (70R-4581)

POLI antibody (70R-4581) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 83 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLI antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POLI is an error-prone DNA polymerase specifically involved in DNA repair.POLI plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls. POLI favors Hoogsteen base-pairing in the active site.POLI inserts the correct base with high-fidelity opposite an adenosine template.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using POLI antibody (70R-4581) | POLI antibody (70R-4581) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors