POLL antibody (70R-5637)

Rabbit polyclonal POLL antibody

Synonyms Polyclonal POLL antibody, Anti-POLL antibody, POL-KAPPA antibody, BETA-N antibody, FLJ46002 antibody, Polymerase (DNA directed) lambda antibody
Cross Reactivity Human
Applications WB
Immunogen POLL antibody was raised using a synthetic peptide corresponding to a region with amino acids SLSEHALSTAVVRNTHGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW
Assay Information POLL Blocking Peptide, catalog no. 33R-8621, is also available for use as a blocking control in assays to test for specificity of this POLL antibody


Western Blot analysis using POLL antibody (70R-5637)

POLL antibody (70R-5637) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POLL is a repair polymerase.It is involved in base excision repair (BER) responsible for repair of lesions that give rise to abasic (AP) sites in DNA. Has both DNA polymerase and terminal transferase activities. Has a 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using POLL antibody (70R-5637) | POLL antibody (70R-5637) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors