POLR1D antibody (70R-2039)

Rabbit polyclonal POLR1D antibody

Synonyms Polyclonal POLR1D antibody, Anti-POLR1D antibody, Rna I Polypeptide D 16Kda antibody, POLR1C antibody, RPAC2 antibody, POLRD-1, RPO1-3 antibody, POLRD-1 antibody, RPA9 antibody, POLRD 1, FLJ20616 antibody, RNA Polymerase I antibody, POLR1D, MGC9850 antibody, RPA16 antibody, POLRD 1 antibody
Cross Reactivity Human
Applications WB
Immunogen POLR1D antibody was raised using a synthetic peptide corresponding to a region with amino acids TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF
Assay Information POLR1D Blocking Peptide, catalog no. 33R-9258, is also available for use as a blocking control in assays to test for specificity of this POLR1D antibody

Images

Western Blot analysis using POLR1D antibody (70R-2039)

POLR1D antibody (70R-2039) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLR1D antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POLR1D belongs to the archaeal rpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR1D is the common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using POLR1D antibody (70R-2039) | POLR1D antibody (70R-2039) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors