POLR3A antibody (70R-2159)

Rabbit polyclonal POLR3A antibody raised against the middle region of POLR3A

Synonyms Polyclonal POLR3A antibody, Anti-POLR3A antibody, hRPC155 antibody, POLRA-3 antibody, POLRA 3, RNA Polymerase IIIA antibody, RPC155 antibody, RPC1 antibody, POLR3A, POLRA-3, POLRA 3 antibody
Specificity POLR3A antibody was raised against the middle region of POLR3A
Cross Reactivity Human
Applications WB
Immunogen POLR3A antibody was raised using the middle region of POLR3A corresponding to a region with amino acids AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT
Assay Information POLR3A Blocking Peptide, catalog no. 33R-1627, is also available for use as a blocking control in assays to test for specificity of this POLR3A antibody

Images

Western Blot analysis using POLR3A antibody (70R-2159)

POLR3A antibody (70R-2159) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 156 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLR3A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3A is the largest and catalytic core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It forms the polymerase active center together with the second largest subunit. A single stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol III. A bridging helix emanates from RPC1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol III by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using POLR3A antibody (70R-2159) | POLR3A antibody (70R-2159) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors