POLR3B antibody (70R-2297)

Rabbit polyclonal POLR3B antibody raised against the C terminal of POLR3B

Synonyms Polyclonal POLR3B antibody, Anti-POLR3B antibody, POLRB-3, POLRB 3, POLRB-3 antibody, RPC2 antibody, FLJ10388 antibody, RNA Polymerase IIIB antibody, POLR3B, POLRB 3 antibody
Specificity POLR3B antibody was raised against the C terminal of POLR3B
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen POLR3B antibody was raised using the C terminal of POLR3B corresponding to a region with amino acids IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED
Assay Information POLR3B Blocking Peptide, catalog no. 33R-3943, is also available for use as a blocking control in assays to test for specificity of this POLR3B antibody

Images

Western Blot analysis using POLR3B antibody (70R-2297)

POLR3B antibody (70R-2297) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 128 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLR3B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POLR3B belongs to the RNA polymerase beta chain family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3B is the second largest core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It is proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol III is composed of mobile elements and RPC2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using POLR3B antibody (70R-2297) | POLR3B antibody (70R-2297) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors