POLR3F antibody (70R-2038)

Rabbit polyclonal POLR3F antibody raised against the middle region of POLR3F

Synonyms Polyclonal POLR3F antibody, Anti-POLR3F antibody, RPC39 antibody, POLRF-3 antibody, POLRF-3, MGC13517 antibody, POLRF 3 antibody, RNA Polymerase III antibody, RPC6 antibody, POLR3F, POLRF 3
Specificity POLR3F antibody was raised against the middle region of POLR3F
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen POLR3F antibody was raised using the middle region of POLR3F corresponding to a region with amino acids LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVE
Assay Information POLR3F Blocking Peptide, catalog no. 33R-5238, is also available for use as a blocking control in assays to test for specificity of this POLR3F antibody


Western Blot analysis using POLR3F antibody (70R-2038)

POLR3F antibody (70R-2038) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of POLR3F antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance POLR3F is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using POLR3F antibody (70R-2038) | POLR3F antibody (70R-2038) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors