PPA1 antibody (70R-1060)

Rabbit polyclonal PPA1 antibody

Synonyms Polyclonal PPA1 antibody, Anti-PPA1 antibody, PP1 antibody, IOPPP antibody, SID6-8061 antibody, PPA 1, PPA 1 antibody, MGC111556 antibody, PPA1, PPA-1, PPA-1 antibody, PP antibody, Pyrophosphatase antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PPA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT
Assay Information PPA1 Blocking Peptide, catalog no. 33R-7346, is also available for use as a blocking control in assays to test for specificity of this PPA1 antibody


Western Blot analysis using PPA1 antibody (70R-1060)

PPA1 antibody (70R-1060) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PPA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPA1 is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PPA1 antibody (70R-1060) | PPA1 antibody (70R-1060) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors