PPAP2A antibody (70R-1660)

Rabbit polyclonal PPAP2A antibody raised against the middle region of PPAP2A

Synonyms Polyclonal PPAP2A antibody, Anti-PPAP2A antibody, PPAPA 2 antibody, PAP2alpha2 antibody, LLP1a antibody, PPAP2A, PAP2 antibody, PAP-2a antibody, PAP2a2 antibody, PPAPA 2, PPAPA-2 antibody, LPP1 antibody, PPAPA-2, PAPalpha1 antibody, Phosphatidic Acid Phosphatase Type 2A antibody
Specificity PPAP2A antibody was raised against the middle region of PPAP2A
Cross Reactivity Human,Mouse,ZebraFish
Applications WB
Immunogen PPAP2A antibody was raised using the middle region of PPAP2A corresponding to a region with amino acids DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL
Assay Information PPAP2A Blocking Peptide, catalog no. 33R-2098, is also available for use as a blocking control in assays to test for specificity of this PPAP2A antibody

Images

Western Blot analysis using PPAP2A antibody (70R-1660)

PPAP2A antibody (70R-1660) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PPAP2A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPAP2A is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is an integral membrane glycoprotein, and has been shown to be a surface enzyme that plays an active role in the hydrolysis and uptake of lipids from extracellular space.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPAP2A antibody (70R-1660) | PPAP2A antibody (70R-1660) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £252.39
Size: 100 ug
OR
Shipping
View Our Distributors