PPAT antibody (70R-2293)

Rabbit polyclonal PPAT antibody raised against the C terminal of PPAT

Synonyms Polyclonal PPAT antibody, Anti-PPAT antibody, Phosphoribosyl Pyrophosphate Amidotransferase antibody, ATASE antibody, PRAT antibody, GPAT antibody
Specificity PPAT antibody was raised against the C terminal of PPAT
Cross Reactivity Human
Applications WB
Immunogen PPAT antibody was raised using the C terminal of PPAT corresponding to a region with amino acids QEGIKFKKQKEKKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW
Assay Information PPAT Blocking Peptide, catalog no. 33R-7523, is also available for use as a blocking control in assays to test for specificity of this PPAT antibody


Western Blot analysis using PPAT antibody (70R-2293)

PPAT antibody (70R-2293) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPAT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PPAT antibody (70R-2293) | PPAT antibody (70R-2293) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors