PPCDC antibody (70R-1240)

Rabbit polyclonal PPCDC antibody raised against the N terminal of PPCDC

Synonyms Polyclonal PPCDC antibody, Anti-PPCDC antibody, FLJ14585 antibody, Phosphopantothenoylcysteine Decarboxylase antibody, MDS018 antibody
Specificity PPCDC antibody was raised against the N terminal of PPCDC
Cross Reactivity Human,Dog
Applications WB
Immunogen PPCDC antibody was raised using the N terminal of PPCDC corresponding to a region with amino acids VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV
Assay Information PPCDC Blocking Peptide, catalog no. 33R-9859, is also available for use as a blocking control in assays to test for specificity of this PPCDC antibody

Images

Western Blot analysis using PPCDC antibody (70R-1240)

PPCDC antibody (70R-1240) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PPCDC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. PPCDC, one of the last enzymes in this pathway, converts phosphopantothenoylcysteine to 4-prime-phosphopantetheine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPCDC antibody (70R-1240) | PPCDC antibody (70R-1240) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors