PPFIBP1 antibody (70R-1229)

Rabbit polyclonal PPFIBP1 antibody

Synonyms Polyclonal PPFIBP1 antibody, Anti-PPFIBP1 antibody, PPFIBP 1, L2 antibody, Liprin Beta 1 antibody, hSGT2 antibody, Ptprf Interacting Protein Binding Protein 1 antibody, PPFIBP1, PPFIBP 1 antibody, PPFIBP-1 antibody, hSgt2p antibody, PPFIBP-1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PPFIBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQM
Assay Information PPFIBP1 Blocking Peptide, catalog no. 33R-7081, is also available for use as a blocking control in assays to test for specificity of this PPFIBP1 antibody

Western Blot analysis using PPFIBP1 antibody (70R-1229)

PPFIBP1 antibody (70R-1229) used at 2.5 ug/ml to detect target protein.

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PPFIBP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPFIBP1 is a member of the LAR protein-tyrosine phosphatase-interacting protein (liprin) family. Liprins interact with members of LAR family of transmembrane protein tyrosine phosphatases, which are known to be important for axon guidance and mammary gland development. It has been proposed that liprins are multivalent proteins that form complex structures and act as scaffolds for the recruitment and anchoring of LAR family of tyrosine phosphatases. This protein was found to interact with S100A4, a calcium-binding protein related to tumor invasiveness and metastasis.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using PPFIBP1 antibody (70R-1229) | PPFIBP1 antibody (70R-1229) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors