PPIB antibody (70R-1863)

Rabbit polyclonal PPIB antibody

Synonyms Polyclonal PPIB antibody, Anti-PPIB antibody, CYP-S1 antibody, MGC14109 antibody, SCYLP antibody, MGC2224 antibody, CYPB antibody, Peptidylprolyl Isomerase B antibody, Cyclophilin B antibody
Cross Reactivity Human,Mouse,Dog
Applications IHC, WB
Immunogen PPIB antibody was raised using a synthetic peptide corresponding to a region with amino acids FITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVIIADC
Assay Information PPIB Blocking Peptide, catalog no. 33R-2937, is also available for use as a blocking control in assays to test for specificity of this PPIB antibody


Immunohistochemical staining using PPIB antibody (70R-1863)

PPIB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PPIB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPIB is a cyclosporine-binding protein and is mainly located within the endoplasmic reticulum. It is associated with the secretory pathway and released in biological fluids. This protein can bind to cells derived from T- and B-lymphocytes, and may regulate cyclosporine A-mediated immunosuppression.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using PPIB antibody (70R-1863) | PPIB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X
  • Western Blot analysis using PPIB antibody (70R-1863) | PPIB antibody (70R-1863) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors