PPIL2 antibody (70R-2369)

Rabbit polyclonal PPIL2 antibody

Synonyms Polyclonal PPIL2 antibody, Anti-PPIL2 antibody, PPIL 2 antibody, PPIL 2, CYP60 antibody, PPIL2, FLJ39930 antibody, Peptidylprolyl Isomerase antibody, MGC33174 antibody, MGC787 antibody, hCyP-60 antibody, PPIL-2 antibody, PPIL-2, Cyclophilin-Like 2 antibody, CYC4 antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAP
Assay Information PPIL2 Blocking Peptide, catalog no. 33R-6143, is also available for use as a blocking control in assays to test for specificity of this PPIL2 antibody

Images

Western Blot analysis using PPIL2 antibody (70R-2369)

PPIL2 antibody (70R-2369) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPIL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPIL2 is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PPIL2 antibody (70R-2369) | PPIL2 antibody (70R-2369) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors